anemone apennina/cơn động kinh

Liên kết được lưu vào khay nhớ tạm

Bài viếtCác thử nghiệm lâm sàngBằng sáng chế

Chọn loại sắp xếp

7 các kết quả

The crude extract from the sea anemone, Bunodosoma caissarum elicits convulsions in mice: possible involvement of the glutamatergic system.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

The crude extract from the sea anemone, Bunodosoma caissarum caused dose-dependent convulsions by i.c.v. route in mice. The involvement of the glutamatergic system in the convulsions was investigated. MK-801 and ketamine, non-competitive NMDA receptor antagonists, prolonged the latencies for

Behavioral and electroencephalographic analysis of seizures induced by intrahippocampal injection of granulitoxin, a neurotoxic peptide from the sea anemone Bunodosoma granulifera.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

In this study, the behavioral and electroencephalographic (EEG) analysis of seizures induced by the intrahippocampal injection in rats of granulitoxin, a neurotoxic peptide from the sea anemone Bunodosoma granulifera, was determined. The first alterations occurred during microinjection of

Partial sequence and toxic effects of granulitoxin, a neurotoxic peptide from the sea anemone Bundosoma granulifera.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

A neurotoxic peptide, granulitoxin (GRX), was isolated from the sea anemone Bunodosoma granulifera. The N-terminal amino acid sequence of GRX is AKTGILDSDGPTVAGNSLSGT and its molecular mass is 4958 Da by electrospray mass spectrometry. This sequence presents a partial degree of homology with other

Iodine labelling of sea anemone toxin II, and binding to normal and denervated diaphragm.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

1. Sea anemone toxin II (ATX II) which keeps the activated sodium channels open, can be labelled at its histidine residues with 125I up to a specific radioactivity of 500 Ci/mmole. Upon intraventricular injection in mice, ATX II causes acute, short-lasting hyperexcitation and convulsions. Its LD50

Isolation and biological characterization of neurotoxic compounds from the sea anemone Lebrunia danae (Duchassaing and Michelotti, 1860).

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

This paper describes two neurotoxic proteins obtained from the Caribbean sea anemone Lebrunia danae. To assess the neurotoxic activity of the venom of L. danae, several bioassays were carried out, and to evaluate the effect of the toxin, Median Lethal Doses (LD(50)) were determined in vivo using sea

Biological activity of sea anemone proteins: I. Toxicity and histopathology.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

The crude as well as partially purified protein fractions from anemone species viz. Heteractis magnifica, Stichodactyla haddoni and Paracodylactis sinensis, collected from the Gulf of Mannar, south east coast of India were found to be toxic at different levels to mice. The mice showed behavioral

Primary structure, behavioral and electroencephalographic effects of an epileptogenic peptide from the sea anemone Bunodosoma cangicum.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

The primary structure of cangitoxin (CGX), a 4958 Da peptide from the sea anemone Bunodosoma cangicum, was determined: GVACRCDSDGPTVRGNSLSGTLWLTGGCPSGWHNCRGSGPFIGYCCKK. CGX contains all the 11 residues that are conserved and the 5 that are conservatively substituted within or between the type 1 and

Tham gia trang
facebook của chúng tôi

Herbal & Natural Medicine

Cơ sở dữ liệu đầy đủ nhất về dược liệu được hỗ trợ bởi khoa học

Hoạt động bằng 55 ngôn ngữ
Phương pháp chữa bệnh bằng thảo dược được hỗ trợ bởi khoa học
Nhận dạng các loại thảo mộc bằng hình ảnh
Bản đồ GPS tương tác - gắn thẻ các loại thảo mộc vào vị trí (sắp ra mắt)
Đọc các ấn phẩm khoa học liên quan đến tìm kiếm của bạn
Tìm kiếm dược liệu theo tác dụng của chúng
Sắp xếp sở thích của bạn và cập nhật các nghiên cứu tin tức, thử nghiệm lâm sàng và bằng sáng chế

Nhập một triệu chứng hoặc một căn bệnh và đọc về các loại thảo mộc có thể hữu ích, nhập một loại thảo mộc và xem các bệnh và triệu chứng mà nó được sử dụng để chống lại.
* Tất cả thông tin dựa trên nghiên cứu khoa học đã được công bố