halophila decipiens/l cystein

Liên kết được lưu vào khay nhớ tạm

Bài viếtCác thử nghiệm lâm sàngBằng sáng chế

Chọn loại sắp xếp

5 các kết quả

Sequence-specific assignment of the 1H and 15N nuclear magnetic resonance spectra of the reduced recombinant high-potential iron-sulfur protein I from Ectothiorhodospira halophila.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

A 1H and 15N NMR investigation through two-dimensional and three-dimensional spectroscopy has been performed on the reduced form ([Fe4S4]2+) of the recombinant high-potential iron-sulfur protein (HiPIP) I from Ectothiorhodospira halophila expressed in Escherichia coli. [Fe4S4]2+ clusters in proteins

The solution structure refinement of the paramagnetic reduced high-potential iron-sulfur protein I from Ectothiorhodospira halophila by using stable isotope labeling and nuclear relaxation.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

The reduced high-potential iron sulfur protein I from Ectothiorhodospira halophila which contains the [4Fe-4S]2+ polymetallic center has been fully labeled with 15N and 13C. The protein is paramagnetic, the nuclear relaxation times of nuclei close to the paramagnetic ion are drastically shortened

Heterologous production of Halorhodospira halophila holo-photoactive yellow protein through tandem expression of the postulated biosynthetic genes.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

The photoactive yellow protein (PYP) is a bacterial photoreceptor which is the structural prototype for the PAS domain superfamily of regulators and receptors. PYP is known to have a unique p-hydroxycinnamic acid chromophore, covalently attached to a cysteine. To date, it has not been shown how

Site-specific mutations provide new insights into the origin of pH effects and alternative spectral forms in the photoactive yellow protein from Halorhodospira halophila.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

Acid/base titrations of wild-type PYP and mutants, either in buffer or in the presence of chaotropes such as thiocyanate, establish the presence of four spectral forms including the following: a neutral form (446-476 nm), an acidic form (350-355 nm), an alkaline form (430-440 nm), and an

Primary structure of a photoactive yellow protein from the phototrophic bacterium Ectothiorhodospira halophila, with evidence for the mass and the binding site of the chromophore.

Chỉ người dùng đã đăng ký mới có thể dịch các bài báo

Đăng nhập Đăng ký

The complete amino acid sequence of the 125-residue photoactive yellow protein (PYP) from Ectothiorhodospira halophila has been determined to be MEHVAFGSEDIENTLAKMDDGQLDGLAFGAIQLDGDGNILQYNAAEGDITGRDPKEVIGKNFFKDVAP+ ++ CTDSPEFYGKFKEGVASGNLNTMFEYTFDYQMTPTKVKVHMKKALSGDSYWVFVKRV. This is the first

Tham gia trang
facebook của chúng tôi

Herbal & Natural Medicine

Cơ sở dữ liệu đầy đủ nhất về dược liệu được hỗ trợ bởi khoa học

Hoạt động bằng 55 ngôn ngữ
Phương pháp chữa bệnh bằng thảo dược được hỗ trợ bởi khoa học
Nhận dạng các loại thảo mộc bằng hình ảnh
Bản đồ GPS tương tác - gắn thẻ các loại thảo mộc vào vị trí (sắp ra mắt)
Đọc các ấn phẩm khoa học liên quan đến tìm kiếm của bạn
Tìm kiếm dược liệu theo tác dụng của chúng
Sắp xếp sở thích của bạn và cập nhật các nghiên cứu tin tức, thử nghiệm lâm sàng và bằng sáng chế

Nhập một triệu chứng hoặc một căn bệnh và đọc về các loại thảo mộc có thể hữu ích, nhập một loại thảo mộc và xem các bệnh và triệu chứng mà nó được sử dụng để chống lại.
* Tất cả thông tin dựa trên nghiên cứu khoa học đã được công bố